What is the catalog number for ZDHHC9 Antibody - middle region?

The catalog number for ZDHHC9 Antibody - middle region is ARP80494_P050-25UL.

What sizes are available for ZDHHC9 Antibody - middle region?

ZDHHC9 Antibody - middle region is available in the following size(s): 25 µL.

Is ZDHHC9 Antibody - middle region in stock?

ZDHHC9 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

ZDHHC9 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Zinc finger, DHHC-type containing 9

Gene Aliases

CGI89, DHHC9, MMSA1, MRXSZ, ZNF379, ZNF380, CXorf11, ZDHHC10

Gene ID

51114

Swiss Prot

Q9Y397

Accession Number

NP_001008223.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZDHHC9

Target

This gene encodes an integral membrane protein that is a member of the zinc finger DHHC domain-containing protein family. The encoded protein forms a complex with golgin subfamily A member 7 and functions as a palmitoyltransferase. This protein specifically palmitoylates HRAS and NRAS. Mutations in this gene are associated with X-linked mental retardation. Alternate splicing results in multiple transcript variants that encode the same protein.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

EDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLEES

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol