What is the catalog number for SLC7A6 Antibody - N-terminal region?

The catalog number for SLC7A6 Antibody - N-terminal region is ARP80319_P050-25UL.

What sizes are available for SLC7A6 Antibody - N-terminal region?

SLC7A6 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is SLC7A6 Antibody - N-terminal region in stock?

SLC7A6 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

SLC7A6 Antibody - N-terminal region

Selected Variant

ARP80319_P050-25UL

Size: 25 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

Solute carrier family 7 (amino acid transporter light chain, y+L system), member 6

Gene Aliases

LAT3, LAT-2, y+LAT-2

Gene ID

9057

Swiss Prot

Q92536

Accession Number

NP_001070253.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC7A6

Target

Involved in the sodium-independent uptake of dibasic amino acids and sodium-dependent uptake of some neutral amino acids. Requires coexpression with SLC3A2/4F2hc to mediate the uptake of arginine, leucine and glutamine. Also acts as an arginine/glutamine exchanger, following an antiport mechanism for amino acid transport, influencing arginine release in exchange for extracellular amino acids. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. Involved in the transport of L-arginine in monocytes. Reduces uptake of ornithine in retinal pigment epithelial (RPE) cells.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

TPTYHLVPNTSQSQVEEDVSSPPQRSSETMQLKKEISLLNGVSLVVGNMI

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

57 kDa

Protein Length

515

NCBI Gene Symbol

SLC7A6

Host or Source

Rabbit

Protein Name

Y+L amino acid transporter 2

Gene Name URL

SLC7A6

Nucleotide Accession Number

NM_001076785.2

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 (Macrophage Marker) (C68/2908R), CF594 conjugate, 0.1mg/mL

BNC942908-500 1x 500 µL