What is the catalog number for PRSS2 Antibody - middle region?

The catalog number for PRSS2 Antibody - middle region is ARP79966_P050-25UL.

What sizes are available for PRSS2 Antibody - middle region?

PRSS2 Antibody - middle region is available in the following size(s): 25 µL.

Is PRSS2 Antibody - middle region in stock?

PRSS2 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

PRSS2 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Protease, serine 2

Gene Aliases

TRY2, TRY8, TRYP2

Gene ID

5645

Swiss Prot

P07478

Accession Number

NP_002761.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PRSS2

Target

This gene belongs to the trypsin family of serine proteases and encodes anionic trypsinogen. It is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus. Enzymes of this family cleave peptide bonds that follow lysine or arginine residues. This protein is found at high levels in pancreatic juice and its upregulation is a characteristic feature of pancreatitis. This protein has also been found to activate pro-urokinase in ovarian tumors, suggesting a function in tumor invasion. In addition, this enzyme is able to cleave across the type II collagen triple helix in rheumatoid arthritis synovitis tissue, potentially participating in the degradation of type II collagen-rich cartilage matrix. Alternative splicing results in multiple transcript variants.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

EGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTA

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol