What is the catalog number for DMTN Antibody - middle region?

The catalog number for DMTN Antibody - middle region is ARP79851_P050-25UL.

What sizes are available for DMTN Antibody - middle region?

DMTN Antibody - middle region is available in the following size(s): 25 µL.

Is DMTN Antibody - middle region in stock?

DMTN Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

DMTN Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Dematin actin binding protein

Gene Aliases

DMT, EPB49

Gene ID

2039

Swiss Prot

Q08495-4

Accession Number

NP_001107607.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EPB49

Target

The protein encoded by this gene is an actin binding and bundling protein that plays a structural role in erythrocytes, by stabilizing and attaching the spectrin/actin cytoskeleton to the erythrocyte membrane in a phosphorylation-dependent manner. This protein contains a core domain in the N-terminus, and a headpiece domain in the C-terminus that binds F-actin. When purified from erythrocytes, this protein exists as a trimer composed of two 48 kDa polypeptides and a 52 kDa polypeptide. The different subunits arise from alternative splicing in the 3' coding region, where the headpiece domain is located. Disruption of this gene has been correlated with the autosomal dominant Marie Unna hereditary hypotrichosis disease, while loss of heterozygosity of this gene is thought to play a role in prostate cancer progression. Alternative splicing results in multiple transcript variants encoding different isoforms.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SLPAYGRTTLSRLQSTEFSPSGSETGSPGLQNGEGQRGRMDRGNSLPCVL

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol