What is the catalog number for SCNN1D Antibody - C-terminal region?

The catalog number for SCNN1D Antibody - C-terminal region is ARP79722_P050-25UL.

What sizes are available for SCNN1D Antibody - C-terminal region?

SCNN1D Antibody - C-terminal region is available in the following size(s): 25 µL.

Is SCNN1D Antibody - C-terminal region in stock?

SCNN1D Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

SCNN1D Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Sodium channel, non voltage gated 1 delta subunit

Gene Aliases

ENaCd, SCNED, dNaCh, ENaCdelta

Gene ID

6339

Swiss Prot

P51172

Accession Number

NP_001123885.2

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SCNN1D

Target

Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RLRRAWFSWPRASPASGASSIKPEASQMPPPAGGTSDDPEPSGPHLPRVM

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol