What is the catalog number for NRXN3 Antibody - N-terminal region?

The catalog number for NRXN3 Antibody - N-terminal region is ARP79675_P050-25UL.

What sizes are available for NRXN3 Antibody - N-terminal region?

NRXN3 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is NRXN3 Antibody - N-terminal region in stock?

NRXN3 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

NRXN3 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Neurexin 3

Gene Aliases

C14orf60

Gene ID

9369

Swiss Prot

Q9HDB5

Accession Number

NP_001098720.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NRXN3

Target

This gene encodes a member of a family of proteins that function in the nervous system as receptors and cell adhesion molecules. Extensive alternative splicing and the use of alternative promoters results in multiple transcript variants and protein isoforms for this gene, but the full-length nature of many of these variants has not been determined. Transcripts that initiate from an upstream promoter encode alpha isoforms, which contain epidermal growth factor-like (EGF-like) sequences and laminin G domains. Transcripts initiating from the downstream promoter encode beta isoforms, which lack EGF-like sequences. Genetic variation at this locus has been associated with a range of behavioral phenotypes, including alcohol dependence and autism spectrum disorder.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SPGSHSQHEHHFHGSKHHSVPISIYRSPVSLRGGHAGATYIFGKSGGLIL

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

70 kDa

Protein Length

637

NCBI Gene Symbol

NRXN3

Host or Source

Rabbit

Protein Name

Neurexin 3

Gene Name URL

NRXN3

Nucleotide Accession Number

NM_004796.5

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Insulin (2D11-H5), CF640R conjugate, 0.1mg/mL

BNC400030-500 1x 500 µL