What is the catalog number for USP19 Antibody - middle region (ARP79531_P050)?

The catalog number for USP19 Antibody - middle region (ARP79531_P050) is ARP79531_P050.

What sizes are available for USP19 Antibody - middle region (ARP79531_P050)?

USP19 Antibody - middle region (ARP79531_P050) is available in the following size(s): 100 µL.

Is USP19 Antibody - middle region (ARP79531_P050) in stock?

USP19 Antibody - middle region (ARP79531_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

USP19 Antibody - middle region (ARP79531_P050)

Selected Variant

ARP79531_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

Ubiquitin specific peptidase 19

Gene Aliases

ZMYND9

Gene ID

10869

Swiss Prot

O94966-5

Accession Number

NP_001186089.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human USP19

Target

Deubiquitinating enzyme that regulates the degradation of various proteins. Deubiquitinates and prevents proteasomal degradation of RNF123 which in turn stimulates CDKN1B ubiquitin-dependent degradation thereby playing a role in cell proliferation. Involved in decreased protein synthesis in atrophying skeletal muscle. Modulates transcription of major myofibrillar proteins. Also involved in turnover of endoplasmic-reticulum-associated degradation (ERAD) substrates. Regulates the stability of BIRC2/c-IAP1 and BIRC3/c-IAP2 by preventing their ubiquitination. Required for cells to mount an appropriate response to hypoxia and rescues HIF1A from degradation in a non-catalytic manner. Plays an important role in 17 beta-estradiol (E2) -inhibited myogenesis. Decreases the levels of ubiquitinated proteins during skeletal muscle formation and acts to repress myogenesis. Exhibits a preference towards 'Lys-63'-linked Ubiquitin chains.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPYTETVDSDGRPDEVVAE

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

156 kDa

Protein Length

1419

NCBI Gene Symbol

USP19

Host or Source

Rabbit

Protein Name

Ubiquitin carboxyl-terminal hydrolase 19

Gene Name URL

USP19

Nucleotide Accession Number

NM_001199160.1

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin D (Tumor Marker) (CTSD/2781), CF405S conjugate, 0.1mg/mL

BNC042781-100 1x 100 µL