Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAN3 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

PAN3 poly (A) specific ribonuclease subunit

Gene ID

255967

Swiss Prot

Q58A45-2

Accession Number

NP_787050.6

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PAN3

Target

Regulatory subunit of the poly (A) -nuclease (PAN) deadenylation complex, one of two cytoplasmic mRNA deadenylases involved in general and miRNA-mediated mRNA turnover. PAN specifically shortens poly (A) tails of RNA and the activity is stimulated by poly (A) -binding protein (PABP) . PAN deadenylation is followed by rapid degradation of the shortened mRNA tails by the CCR4-NOT complex. Deadenylated mRNAs are then degraded by two alternative mechanisms, namely exosome-mediated 3'-5' exonucleolytic degradation, or deadenlyation-dependent mRNA decaping and subsequent 5'-3' exonucleolytic degradation by XRN1. PAN3 acts as a positive regulator for PAN activity, recruiting the catalytic subunit PAN2 to mRNA via its interaction with RNA and PABP, and to miRNA targets via its interaction with GW182 family proteins.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

KAFAEPSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWGQHEGPLPRQ

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

63 kDa

Protein Length

575

NCBI Gene Symbol

PAN3

Host or Source

Rabbit

Protein Name

PAB-dependent poly (A) -specific ribonuclease subunit PAN3

Gene Name URL

PAN3

Nucleotide Accession Number

NM_175854.7

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP33 (Ubiquitin-specific-processing Protease 33, Ubiquitin Carboxyl-terminal Hydrolase 33, Deubiquitinating Enzyme 33, Ubiquitin Thioesterase 33, VHL-interacting Deubiquitinating Enzyme 1, VDU1, hVDU1, KIAA1097) (MaxLight 750)
MBS6398225-01 0.1 mL

USP33 (Ubiquitin-specific-processing Protease 33, Ubiquitin Carboxyl-terminal Hydrolase 33, Deubiquitinating Enzyme 33, Ubiquitin Thioesterase 33, VHL-interacting Deubiquitinating Enzyme 1, VDU1, hVDU1, KIAA1097) (MaxLight 750)

Sign In for Pricing
View Details
USP33 (Ubiquitin-specific-processing Protease 33, Ubiquitin Carboxyl-terminal Hydrolase 33, Deubiquitinating Enzyme 33, Ubiquitin Thioesterase 33, VHL-interacting Deubiquitinating Enzyme 1, VDU1, hVDU1, KIAA1097) (MaxLight 750)
MBS6398225-02 5x 0.1 mL

USP33 (Ubiquitin-specific-processing Protease 33, Ubiquitin Carboxyl-terminal Hydrolase 33, Deubiquitinating Enzyme 33, Ubiquitin Thioesterase 33, VHL-interacting Deubiquitinating Enzyme 1, VDU1, hVDU1, KIAA1097) (MaxLight 750)

Sign In for Pricing
View Details
ACPP Protein (C-His-AVI, Human)
P521927 100 µg

ACPP Protein (C-His-AVI, Human)

Sign In for Pricing
View Details
Recombinant Human TSPAN1 Protein - (Dry Ice)
H00010103-Q01-10ug 10 µg

Recombinant Human TSPAN1 Protein - (Dry Ice)

Sign In for Pricing
View Details
AdmiRa-hsa-miR-3913-3p Virus
mh1819 250 µL

AdmiRa-hsa-miR-3913-3p Virus

Sign In for Pricing
View Details
RGD1308430 Protein Vector (Rat) (pPM-C-His)
PV299541 500 ng

RGD1308430 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details