What is the catalog number for SLC22A4 Antibody - C-terminal region?

The catalog number for SLC22A4 Antibody - C-terminal region is ARP79165_P050-25UL.

What sizes are available for SLC22A4 Antibody - C-terminal region?

SLC22A4 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is SLC22A4 Antibody - C-terminal region in stock?

SLC22A4 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

SLC22A4 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Solute carrier family 22 member 4

Gene Aliases

OCTN1, DFNB60

Gene ID

6583

Swiss Prot

Q9H015

Accession Number

NP_003050.2

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SLC22A4

Target

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is an organic cation transporter and plasma integral membrane protein containing eleven putative transmembrane domains as well as a nucleotide-binding site motif. Transport by this protein is at least partially ATP-dependent.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GILTLFFPESLGMTLPETLEQMQKVKWFRSGKKTRDSMETEENPKVLITA

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol