Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR1 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Chemokine (C-C motif) receptor 1

Gene Aliases

CKR1, CD191, CKR-1, HM145, CMKBR1, MIP1aR, SCYAR1

Gene ID

1230

Swiss Prot

Q5U003

Accession Number

NP_001286.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CCR1

Target

This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The ligands of this receptor include macrophage inflammatory protein 1 alpha (MIP-1 alpha), regulated on activation normal T expressed and secreted protein (RANTES), monocyte chemoattractant protein 3 (MCP-3), and myeloid progenitor inhibitory factor-1 (MPIF-1) . Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. Knockout studies of the mouse homolog suggested the roles of this gene in host protection from inflammatory response, and susceptibility to virus and parasite. This gene and other chemokine receptor genes, including CCR2, CCRL2, CCR3, CCR5 and CCXCR1, are found to form a gene cluster on chromosome 3p.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSEIFFIILL

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

39 kDa

Protein Length

355

NCBI Gene Symbol

CCR1

Host or Source

Rabbit

Protein Name

C-C chemokine receptor type 1

Gene Name URL

CCR1

Nucleotide Accession Number

NM_001295.2.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Dictyostelium discoideum Probable farnesyl diphosphate synthase DDB_G0278823 (DDB_G0278823)
MBS1284416-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum Probable farnesyl diphosphate synthase DDB_G0278823 (DDB_G0278823)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Probable farnesyl diphosphate synthase DDB_G0278823 (DDB_G0278823)
MBS1284416-02 0.02 mg (Yeast)

Recombinant Dictyostelium discoideum Probable farnesyl diphosphate synthase DDB_G0278823 (DDB_G0278823)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Probable farnesyl diphosphate synthase DDB_G0278823 (DDB_G0278823)
MBS1284416-03 0.1 mg (E-Coli)

Recombinant Dictyostelium discoideum Probable farnesyl diphosphate synthase DDB_G0278823 (DDB_G0278823)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Probable farnesyl diphosphate synthase DDB_G0278823 (DDB_G0278823)
MBS1284416-04 0.1 mg (Yeast)

Recombinant Dictyostelium discoideum Probable farnesyl diphosphate synthase DDB_G0278823 (DDB_G0278823)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Probable farnesyl diphosphate synthase DDB_G0278823 (DDB_G0278823)
MBS1284416-05 0.02 mg (Baculovirus)

Recombinant Dictyostelium discoideum Probable farnesyl diphosphate synthase DDB_G0278823 (DDB_G0278823)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Probable farnesyl diphosphate synthase DDB_G0278823 (DDB_G0278823)
MBS1284416-06 0.02 mg (Mammalian-Cell)

Recombinant Dictyostelium discoideum Probable farnesyl diphosphate synthase DDB_G0278823 (DDB_G0278823)

Sign In for Pricing
View Details