What is the catalog number for SIGMAR1 Antibody - middle region (ARP79102_P050)?

The catalog number for SIGMAR1 Antibody - middle region (ARP79102_P050) is ARP79102_P050.

What sizes are available for SIGMAR1 Antibody - middle region (ARP79102_P050)?

SIGMAR1 Antibody - middle region (ARP79102_P050) is available in the following size(s): 100 µL.

Is SIGMAR1 Antibody - middle region (ARP79102_P050) in stock?

SIGMAR1 Antibody - middle region (ARP79102_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

SIGMAR1 Antibody - middle region (ARP79102_P050)

Selected Variant

ARP79102_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

Sigma non-opioid intracellular receptor 1

Gene Aliases

SRBP, ALS16, DSMA2, OPRS1, SR-BP, SIG-1R, SR-BP1, sigma1R, hSigmaR1

Gene ID

10280

Swiss Prot

Q99720

Accession Number

NP_001269134.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SIGMAR1

Target

This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Mutations in this gene has been associated with juvenile amyotrophic lateral sclerosis 16. Alternative splicing of this gene results in transcript variants encoding distinct isoforms.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

PGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRS

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

25 kDa

Protein Length

223

NCBI Gene Symbol

SIGMAR1

Host or Source

Rabbit

Protein Name

Sigma non-opioid intracellular receptor 1

Gene Name URL

SIGMAR1

Nucleotide Accession Number

NM_001282205.1

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (Endothelial Cell Marker) (rC31.3), CF405S conjugate, 0.1mg/mL

BNC043462-500 1x 500 µL