What is the catalog number for C2 Antibody - middle region (ARP79070_P050)?

The catalog number for C2 Antibody - middle region (ARP79070_P050) is ARP79070_P050.

What sizes are available for C2 Antibody - middle region (ARP79070_P050)?

C2 Antibody - middle region (ARP79070_P050) is available in the following size(s): 100 µL.

Is C2 Antibody - middle region (ARP79070_P050) in stock?

C2 Antibody - middle region (ARP79070_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

C2 Antibody - middle region (ARP79070_P050)

Selected Variant

ARP79070_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

Complement component 2

Gene Aliases

CO2, ARMD14

Gene ID

717

Swiss Prot

B4DQI1

Accession Number

NP_001269386.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C2

Target

Component C2 is a serum glycoprotein that functions as part of the classical pathway of the complement system. Activated C1 cleaves C2 into C2a and C2b. The serine proteinase C2a then combines with complement factor 4b to create the C3 or C5 convertase. Deficiency of C2 has been reported to associated with certain autoimmune diseases and SNPs in this gene have been associated with altered susceptibility to age-related macular degeneration. This gene localizes within the class III region of the MHC on the short arm of chromosome 6. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described in publications but their full-length sequence has not been determined.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SRDMTEVISSLENANYKDHENGTGTNTYAALNSVYLMMNNQMRLLGMETM

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

55 kDa

Protein Length

506

NCBI Gene Symbol

Host or Source

Rabbit

Protein Name

Complement C2

Gene Name URL

Nucleotide Accession Number

NM_001282457.1

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (HSPB1/774), CF405S conjugate, 0.1mg/mL

BNC040774-500 1x 500 µL