Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF4 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Ras association domain family member 4

Gene Aliases

AD037

Gene ID

83937

Swiss Prot

P50749

Accession Number

NP_114412.2

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RASSF4

Target

The function of this gene has not yet been determined but may involve a role in tumor suppression. Alternative splicing of this gene results in several transcript variants; however, most of the variants have not been fully described.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

TKSDASCMSQRRPKCRAPGEAQRIRRHRFSINGHFYNHKTSVFTPAYGSV

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

35 kDa

Protein Length

326

NCBI Gene Symbol

RASSF4

Host or Source

Rabbit

Protein Name

Ras association domain-containing protein 4

Gene Name URL

RASSF4

Nucleotide Accession Number

NM_014737.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elp4 Rat shRNA Plasmid (Locus ID 687694)
TR708277 1 Kit

Elp4 Rat shRNA Plasmid (Locus ID 687694)

Sign In for Pricing
View Details
Collagen IV (Collagen Alpha-1 (IV) Chain, Collagen IV Alpha 1 Polypeptide, Collagen Type IV Alpha 1, COL4A1, Collagen Alpha-2 (IV) Chain, Collagen IV Alpha 2 Polypeptide, Collagen Type IV Alpha 2, COL4A2, Collagen alpha-3 (IV) Chain, Collagen Type IV Alpha 3, COL4A3, Collagen alpha-4 (IV) Chain, Collagen Type IV Alpha 4, COL4A4, Collagen alpha-5 (IV) Chain, Collagen Type IV Alpha 5, COL4A5, Collagen alpha-6 (IV) Chain, Collagen Type IV Alpha 6, COL4A6, Arresten, ASLN, ATS, CA44, CA54, Canstatin, DKFZp686I14213, FLJ22259, Goodpasture Antigen, MGC42377, MGC167109) discontinued
C7510-53D 1 mL

Collagen IV (Collagen Alpha-1 (IV) Chain, Collagen IV Alpha 1 Polypeptide, Collagen Type IV Alpha 1, COL4A1, Collagen Alpha-2 (IV) Chain, Collagen IV Alpha 2 Polypeptide, Collagen Type IV Alpha 2, COL4A2, Collagen alpha-3 (IV) Chain, Collagen Type IV Alpha 3, COL4A3, Collagen alpha-4 (IV) Chain, Collagen Type IV Alpha 4, COL4A4, Collagen alpha-5 (IV) Chain, Collagen Type IV Alpha 5, COL4A5, Collagen alpha-6 (IV) Chain, Collagen Type IV Alpha 6, COL4A6, Arresten, ASLN, ATS, CA44, CA54, Canstatin, DKFZp686I14213, FLJ22259, Goodpasture Antigen, MGC42377, MGC167109) discontinued

Sign In for Pricing
View Details
DW-1350 100mg
A12250-100 100 mg

DW-1350 100mg

Sign In for Pricing
View Details
RFX4-set siRNA/shRNA/RNAi Lentivector (Human)
38882091 4x 500 ng

RFX4-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
AIFM2 Antibody, HRP conjugated
A68621-100UL 100 µL

AIFM2 Antibody, HRP conjugated

Sign In for Pricing
View Details
PRAK (MAPKAPK5) Mouse Monoclonal Antibody [Clone ID: LBI1D11]
AMM16384VCF 100 µg

PRAK (MAPKAPK5) Mouse Monoclonal Antibody [Clone ID: LBI1D11]

Sign In for Pricing
View Details