What is the catalog number for JAK1 Antibody - N-terminal region?

The catalog number for JAK1 Antibody - N-terminal region is ARP77948_P050-25UL.

What sizes are available for JAK1 Antibody - N-terminal region?

JAK1 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is JAK1 Antibody - N-terminal region in stock?

JAK1 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

JAK1 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Janus kinase 1

Gene Aliases

JTK3, AIIDE, JAK1A, JAK1B

Gene ID

3716

Swiss Prot

P23458

Accession Number

NP_002218.2

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human JAK1

Target

Janus kinase 1 (JAK1), is a member of a new class of protein-tyrosine kinases (PTK) characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain. The second phosphotransferase domain bears all the hallmarks of a protein kinase, although its structure differs significantly from that of the PTK and threonine/serine kinase family members. JAK1 is a large, widely expressed membrane-associated phosphoprotein. JAK1 is involved in the interferon-alpha/beta and -gamma signal transduction pathways. The reciprocal interdependence between JAK1 and TYK2 activities in the interferon-alpha pathway, and between JAK1 and JAK2 in the interferon-gamma pathway, may reflect a requirement for these kinases in the correct assembly of interferon receptor complexes. These kinases couple cytokine ligand binding to tyrosine phosphorylation of various known signaling proteins and of a unique family of transcription factors termed the signal transducers and activators of transcription, or STATs.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RMRFYFTNWHGTNDNEQSVWRHSPKKQKNGYEKKKIPDATPLLDASSLEY

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol