What is the catalog number for KIR2DL5A Antibody - middle region (ARP77583_P050)?

The catalog number for KIR2DL5A Antibody - middle region (ARP77583_P050) is ARP77583_P050.

What sizes are available for KIR2DL5A Antibody - middle region (ARP77583_P050)?

KIR2DL5A Antibody - middle region (ARP77583_P050) is available in the following size(s): 100 µL.

Is KIR2DL5A Antibody - middle region (ARP77583_P050) in stock?

KIR2DL5A Antibody - middle region (ARP77583_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

KIR2DL5A Antibody - middle region (ARP77583_P050)

Selected Variant

ARP77583_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

Killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 5A

Gene Aliases

CD158F, KIR2DL5, KIR2DL5.1, KIR2DL5.3

Gene ID

57292

Swiss Prot

Q8N109

Accession Number

NP_065396.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KIR2DL5A

Target

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC) . The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2) . The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MDQEPAGDRTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKTPP

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

41 kDa

Protein Length

375

NCBI Gene Symbol

KIR2DL5A

Host or Source

Rabbit

Protein Name

Killer cell immunoglobulin-like receptor 2DL5A

Gene Name URL

KIR2DL5A

Nucleotide Accession Number

NM_020535.3

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PEF1 Antibody Picoband®, Dylight550 Conjugate

A09591-2-Dylight550 100 µg