What is the catalog number for OR2J2 Antibody - C-terminal region (ARP77275_P050)?

The catalog number for OR2J2 Antibody - C-terminal region (ARP77275_P050) is ARP77275_P050.

What sizes are available for OR2J2 Antibody - C-terminal region (ARP77275_P050)?

OR2J2 Antibody - C-terminal region (ARP77275_P050) is available in the following size(s): 100 µL.

Is OR2J2 Antibody - C-terminal region (ARP77275_P050) in stock?

OR2J2 Antibody - C-terminal region (ARP77275_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

OR2J2 Antibody - C-terminal region (ARP77275_P050)

Selected Variant

ARP77275_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

Olfactory receptor, family 2, subfamily J, member 2

Gene Aliases

OR6-8, OR6-19, ORL684, OR6.3.8, hs6M1-6, dJ80I19.4

Gene ID

26707

Swiss Prot

O76002

Accession Number

NP_112167.2

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OR2J2

Target

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

YLQPPSENSPDQGKFIALFYTVVTPSLNPLIYTLRNKHVKGAAKRLLGWE

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

35 kDa

Protein Length

167

NCBI Gene Symbol

OR2J2

Host or Source

Rabbit

Protein Name

Olfactory receptor 2J2

Gene Name URL

OR2J2

Nucleotide Accession Number

NM_030905.2

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD14 (Monocyte / Macrophage Marker) (LPSR/2397), CF568 conjugate, 0.1mg/mL

BNC682397-500 1x 500 µL