What is the catalog number for OXSR1 Antibody - middle region?

The catalog number for OXSR1 Antibody - middle region is ARP76939_P050-25UL.

What sizes are available for OXSR1 Antibody - middle region?

OXSR1 Antibody - middle region is available in the following size(s): 25 µL.

Is OXSR1 Antibody - middle region in stock?

OXSR1 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

OXSR1 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Oxidative stress responsive 1

Gene Aliases

OSR1

Gene ID

9943

Swiss Prot

O95747

Accession Number

NP_005100.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human OXSR1

Target

The product of this gene belongs to the Ser/Thr protein kinase family of proteins. It regulates downstream kinases in response to environmental stress, and may play a role in regulating the actin cytoskeleton.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RVPGSSGRLHKTEDGGWEWSDDEFDEESEEGKAAISQLRSPRVKESISNS

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol