What is the catalog number for INPP4B Antibody - middle region?

The catalog number for INPP4B Antibody - middle region is ARP76799_P050-25UL.

What sizes are available for INPP4B Antibody - middle region?

INPP4B Antibody - middle region is available in the following size(s): 25 µL.

Is INPP4B Antibody - middle region in stock?

INPP4B Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

INPP4B Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Inositol polyphosphate-4-phosphatase type II B

Gene ID

8821

Swiss Prot

O15327

Accession Number

NP_001095139.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human INPP4B

Target

INPP4B encodes the inositol polyphosphate 4-phosphatase type II, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 4 of the inositol ring from inositol 3,4-bisphosphate. There is limited data to suggest that the human type II enzyme is subject to alternative splicing, as has been established for the type I enzyme.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

HHSDYDEEEWDRVWANVGKSLNCIIAMVDKLIERDGGSEGSGGNNDGEKE

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol