What is the catalog number for UGT2B17 Antibody - middle region?

The catalog number for UGT2B17 Antibody - middle region is ARP76685_P050-25UL.

What sizes are available for UGT2B17 Antibody - middle region?

UGT2B17 Antibody - middle region is available in the following size(s): 25 µL.

Is UGT2B17 Antibody - middle region in stock?

UGT2B17 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

UGT2B17 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

UDP glucuronosyltransferase 2 family, polypeptide B17

Gene Aliases

BMND12, UDPGT2B17

Gene ID

7367

Swiss Prot

O75795

Accession Number

NP_001068.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UGT2B17

Target

This gene encodes a member of the uridine diphosphoglucuronosyltransferase protein family. The encoded enzyme catalyzes the transfer of glucuronic acid from uridine diphosphoglucuronic acid to a diverse array of substrates including steroid hormones and lipid-soluble drugs. This process, known as glucuronidation, is an intermediate step in the metabolism of steroids. Copy number variation in this gene is associated with susceptibility to osteoporosis.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLP

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol