What is the catalog number for TRAF3 Antibody - C-terminal region (ARP76669_P050)?

The catalog number for TRAF3 Antibody - C-terminal region (ARP76669_P050) is ARP76669_P050.

What sizes are available for TRAF3 Antibody - C-terminal region (ARP76669_P050)?

TRAF3 Antibody - C-terminal region (ARP76669_P050) is available in the following size(s): 100 µL.

Is TRAF3 Antibody - C-terminal region (ARP76669_P050) in stock?

TRAF3 Antibody - C-terminal region (ARP76669_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

TRAF3 Antibody - C-terminal region (ARP76669_P050)

Selected Variant

ARP76669_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

TNF receptor-associated factor 3

Gene Aliases

CAP1, LAP1, CAP-1, CRAF1, IIAE5, CD40bp, RNF118

Gene ID

7187

Swiss Prot

Q13114

Accession Number

NP_001186356.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TRAF3

Target

The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in the signal transduction of CD40, a TNFR family member important for the activation of the immune response. This protein is found to be a critical component of the lymphotoxin-beta receptor (LTbetaR) signaling complex, which induces NF-kappaB activation and cell death initiated by LTbeta ligation. Epstein-Barr virus encoded latent infection membrane protein-1 (LMP1) can interact with this and several other members of the TRAF family, which may be essential for the oncogenic effects of LMP1. Several alternatively spliced transcript variants encoding three distinct isoforms have been reported.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENG

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

64 kDa

Protein Length

167

NCBI Gene Symbol

TRAF3

Host or Source

Rabbit

Protein Name

TNF receptor-associated factor 3

Gene Name URL

TRAF3

Nucleotide Accession Number

NM_001199427.1

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha B Crystallin Recombinant Rabbit Monoclonal Antibody [JA50-32]

ET1704-60 100 µL