Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGM3 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Transglutaminase 3

Gene Aliases

TGE, UHS2

Gene ID

7053

Swiss Prot

Q08188

Accession Number

NP_003236.3

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TGM3

Target

Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites and their activity is calcium-dependent. The protein encoded by this gene consists of two polypeptide chains activated from a single precursor protein by proteolysis. The encoded protein is involved the later stages of cell envelope formation in the epidermis and hair follicle.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

NGVLAGNWSGTYTGGRDPRSWNGSVEILKNWKKSGFSPVRYGQCWVFAGT

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

77 kDa

Protein Length

167

NCBI Gene Symbol

TGM3

Host or Source

Rabbit

Protein Name

Protein-glutamine gamma-glutamyltransferase E

Gene Name URL

TGM3

Nucleotide Accession Number

NM_003245.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMR1 (EGF-like Module Containing Mucin-like Hormone Receptor-like 1, EMR1 Hormone Receptor, Cell Surface Glycoprotein EMR1, Cell Surface Glycoprotein F4/80, DD7A5-7, EGF-TM7, F4/80, Gpf480, Lymphocyte Antigen 71, Ly71, TM7LN3) (FITC)
MBS6249837-01 0.1 mL

EMR1 (EGF-like Module Containing Mucin-like Hormone Receptor-like 1, EMR1 Hormone Receptor, Cell Surface Glycoprotein EMR1, Cell Surface Glycoprotein F4/80, DD7A5-7, EGF-TM7, F4/80, Gpf480, Lymphocyte Antigen 71, Ly71, TM7LN3) (FITC)

Sign In for Pricing
View Details
EMR1 (EGF-like Module Containing Mucin-like Hormone Receptor-like 1, EMR1 Hormone Receptor, Cell Surface Glycoprotein EMR1, Cell Surface Glycoprotein F4/80, DD7A5-7, EGF-TM7, F4/80, Gpf480, Lymphocyte Antigen 71, Ly71, TM7LN3) (FITC)
MBS6249837-02 5x 0.1 mL

EMR1 (EGF-like Module Containing Mucin-like Hormone Receptor-like 1, EMR1 Hormone Receptor, Cell Surface Glycoprotein EMR1, Cell Surface Glycoprotein F4/80, DD7A5-7, EGF-TM7, F4/80, Gpf480, Lymphocyte Antigen 71, Ly71, TM7LN3) (FITC)

Sign In for Pricing
View Details
E3 ubiquitin-protein ligase MARCH1 (MARCH1) Human ELISA Kit
D0617 96 Tests

E3 ubiquitin-protein ligase MARCH1 (MARCH1) Human ELISA Kit

Sign In for Pricing
View Details
ZHX2 Human Gene Knockout Kit (CRISPR)
KN408321 1 Kit

ZHX2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Complement C3c alpha' chain fragment 1 Antibody, AbBy Fluor™ 594 Conjugated
bs-4874R-BF594 100 µL

Complement C3c alpha' chain fragment 1 Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Nrtn Mouse Gene Knockout Kit (CRISPR)
KN511248 1 Kit

Nrtn Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details