Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCN2 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Transcobalamin 2

Gene Aliases

II, TC, TC2, TC-2, TCII, TC II, D22S676, D22S750

Gene ID

6948

Swiss Prot

P20062

Accession Number

NP_000346.2

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TCN2

Target

This gene encodes a member of the vitamin B12-binding protein family. This family of proteins, alternatively referred to as R binders, is expressed in various tissues and secretions. This plasma protein binds cobalamin and mediates the transport of cobalamin into cells. This protein and other mammalian cobalamin-binding proteins, such as transcobalamin I and gastric intrisic factor, may have evolved by duplication of a common ancestral gene. Alternative splicing results in multiple transcript variants.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GHKGDRLVSQLKWFLEDEKRAIGHDHKGHPHTSYYQYGLGILALCLHQKR

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

47 kDa

Protein Length

427

NCBI Gene Symbol

TCN2

Host or Source

Rabbit

Protein Name

Transcobalamin-2

Gene Name URL

TCN2

Nucleotide Accession Number

NM_000355.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smad2,3 (Small Mothers Against Decapentaplegic Deleted in Pancreatic Carcinoma) (MaxLight 405) discontinued
S1014-53A-ML405 100 µL

Smad2,3 (Small Mothers Against Decapentaplegic Deleted in Pancreatic Carcinoma) (MaxLight 405) discontinued

Sign In for Pricing
View Details
CBF, CT (CCAAT/Enhancer-binding Protein zeta, CCAAT-box-binding Transcription Factor, CCAAT-binding Factor, CBF, CEBPZ, CBF2) (MaxLight 550)
MBS6467792-01 0.1 mL

CBF, CT (CCAAT/Enhancer-binding Protein zeta, CCAAT-box-binding Transcription Factor, CCAAT-binding Factor, CBF, CEBPZ, CBF2) (MaxLight 550)

Sign In for Pricing
View Details
CBF, CT (CCAAT/Enhancer-binding Protein zeta, CCAAT-box-binding Transcription Factor, CCAAT-binding Factor, CBF, CEBPZ, CBF2) (MaxLight 550)
MBS6467792-02 5x 0.1 mL

CBF, CT (CCAAT/Enhancer-binding Protein zeta, CCAAT-box-binding Transcription Factor, CCAAT-binding Factor, CBF, CEBPZ, CBF2) (MaxLight 550)

Sign In for Pricing
View Details
Mug2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3722205 3x 1.0 µg

Mug2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
IFT57 (DERP8, ESRRBL1, HIPPI, Intraflagellar Transport Protein 57 Homolog, Dermal Papilla-derived Protein 8, Estrogen-related Receptor beta-like Protein 1, HIP1-interacting Protein, MHS4R2, FLJ10147) (APC)
128325-APC 100 µL

IFT57 (DERP8, ESRRBL1, HIPPI, Intraflagellar Transport Protein 57 Homolog, Dermal Papilla-derived Protein 8, Estrogen-related Receptor beta-like Protein 1, HIP1-interacting Protein, MHS4R2, FLJ10147) (APC)

Sign In for Pricing
View Details
Lentiviral human CCDC13 shRNA (UAS) - Lentiviral human CCDC13 shRNA (UAS, GFP) plasmid
GTR15315685 1 Vial

Lentiviral human CCDC13 shRNA (UAS) - Lentiviral human CCDC13 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details