What is the catalog number for RBBP4 Antibody - C-terminal region (ARP76538_P050)?

The catalog number for RBBP4 Antibody - C-terminal region (ARP76538_P050) is ARP76538_P050.

What sizes are available for RBBP4 Antibody - C-terminal region (ARP76538_P050)?

RBBP4 Antibody - C-terminal region (ARP76538_P050) is available in the following size(s): 100 µL.

Is RBBP4 Antibody - C-terminal region (ARP76538_P050) in stock?

RBBP4 Antibody - C-terminal region (ARP76538_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

RBBP4 Antibody - C-terminal region (ARP76538_P050)

Selected Variant

ARP76538_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

Retinoblastoma binding protein 4

Gene Aliases

NURF55, RBAP48, lin-53

Gene ID

5928

Swiss Prot

Q09028

Accession Number

NP_001128727.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RBBP4

Target

This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

AKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQG

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

48 kDa

Protein Length

167

NCBI Gene Symbol

RBBP4

Host or Source

Rabbit

Protein Name

Histone-binding protein RBBP4

Gene Name URL

RBBP4

Nucleotide Accession Number

NM_001135255.1

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MiTF (Microphthalmia Transcription Factor) (MITF/915), CF488A conjugate, 0.1mg/mL

BNC880915-100 1x 100 µL