Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA7 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Proteasome subunit alpha 7

Gene Aliases

C6, HSPC, RC6-1, XAPC7, HEL-S-276

Gene ID

5688

Swiss Prot

O14818

Accession Number

NP_002783.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PSMA7

Target

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the peptidase T1A family that functions as a 20S core alpha subunit. The encoded protein interacts with the hepatitis B virus X protein and plays a role in regulating hepatitis C virus internal ribosome entry site (IRES) activity, an activity essential for viral replication. The encoded protein also plays a role in the cellular stress response by regulating hypoxia-inducible factor-1alpha. A pseudogene of this gene is located on the long arm of chromosome 9.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

28 kDa

Protein Length

167

NCBI Gene Symbol

PSMA7

Host or Source

Rabbit

Protein Name

Proteasome subunit alpha type-7

Gene Name URL

PSMA7

Nucleotide Accession Number

NM_002792.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-323a-3p mimic
HY-R00676-01 5 nmol

Hsa-miR-323a-3p mimic

Sign In for Pricing
View Details
Hsa-miR-323a-3p mimic
HY-R00676-02 20 nmol

Hsa-miR-323a-3p mimic

Sign In for Pricing
View Details
Recombinant Phospho-Smad2 (Ser250) Monoclonal Antibody
AN300960L-01 50 µL

Recombinant Phospho-Smad2 (Ser250) Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Phospho-Smad2 (Ser250) Monoclonal Antibody
AN300960L-02 100 µL

Recombinant Phospho-Smad2 (Ser250) Monoclonal Antibody

Sign In for Pricing
View Details
Nori® Canine 2-Plex ELISA Kits-Myoglobin/MPO
GR226085 96 Well

Nori® Canine 2-Plex ELISA Kits-Myoglobin/MPO

Sign In for Pricing
View Details
IFNGR1 Antibody
A17655-100UG 100 µg

IFNGR1 Antibody

Sign In for Pricing
View Details