What is the catalog number for PPP3CC Antibody - middle region (ARP76485_P050)?

The catalog number for PPP3CC Antibody - middle region (ARP76485_P050) is ARP76485_P050.

What sizes are available for PPP3CC Antibody - middle region (ARP76485_P050)?

PPP3CC Antibody - middle region (ARP76485_P050) is available in the following size(s): 100 µL.

Is PPP3CC Antibody - middle region (ARP76485_P050) in stock?

PPP3CC Antibody - middle region (ARP76485_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

PPP3CC Antibody - middle region (ARP76485_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Protein phosphatase 3, catalytic subunit, gamma isozyme

Gene Aliases

CNA3, CALNA3, PP2Bgamma

Gene ID

5533

Swiss Prot

P48454

Accession Number

NP_001230903.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPP3CC

Target

Calcineurin is a calcium-dependent, calmodulin-stimulated protein phosphatase involved in the downstream regulation of dopaminergic signal transduction. Calcineurin is composed of a regulatory subunit and a catalytic subunit. The protein encoded by this gene represents one of the regulatory subunits that has been found for calcineurin. Three transcript variants encoding different isoforms have been found for this gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GMSPEITSLDDIRKLDRFTEPPAFGPVCDLLWSDPSEDYGNEKTLEHYTH

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol