Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGEA10 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Melanoma antigen family A10

Gene Aliases

CT1.10, MAGE10

Gene ID

4109

Swiss Prot

P43363

Accession Number

NP_001011543.2

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MAGEA10

Target

This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream melanoma antigen family A, 5 (MAGEA5) gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVAS

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

41 kDa

Protein Length

167

NCBI Gene Symbol

MAGEA10

Host or Source

Rabbit

Protein Name

Melanoma-associated antigen 10

Gene Name URL

MAGEA10

Nucleotide Accession Number

NM_001011543.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Bcl-6 Antibody (A6C8-R)
NBP3-32075 100 µL

Mouse Monoclonal Bcl-6 Antibody (A6C8-R)

Sign In for Pricing
View Details
NR4A2 (Nuclear Receptor Subfamily 4 Group A Member 2, Immediate-early Response Protein NOT, Orphan Nuclear Receptor NURR1, Transcriptionally-inducible Nuclear Receptor, NOT, NURR1, TINUR) (MaxLight 405)
MBS6191516-01 0.1 mL

NR4A2 (Nuclear Receptor Subfamily 4 Group A Member 2, Immediate-early Response Protein NOT, Orphan Nuclear Receptor NURR1, Transcriptionally-inducible Nuclear Receptor, NOT, NURR1, TINUR) (MaxLight 405)

Sign In for Pricing
View Details
NR4A2 (Nuclear Receptor Subfamily 4 Group A Member 2, Immediate-early Response Protein NOT, Orphan Nuclear Receptor NURR1, Transcriptionally-inducible Nuclear Receptor, NOT, NURR1, TINUR) (MaxLight 405)
MBS6191516-02 5x 0.1 mL

NR4A2 (Nuclear Receptor Subfamily 4 Group A Member 2, Immediate-early Response Protein NOT, Orphan Nuclear Receptor NURR1, Transcriptionally-inducible Nuclear Receptor, NOT, NURR1, TINUR) (MaxLight 405)

Sign In for Pricing
View Details
SGCG Adenovirus (Human)
43623051 1.0 mL

SGCG Adenovirus (Human)

Sign In for Pricing
View Details
Elmo1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4039705 3x 1.0 µg

Elmo1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
CE120 rabbit pAb
MBS8600603-01 0.1 mL

CE120 rabbit pAb

Sign In for Pricing
View Details