What is the catalog number for KRT2 Antibody - middle region?

The catalog number for KRT2 Antibody - middle region is ARP76336_P050-25UL.

What sizes are available for KRT2 Antibody - middle region?

KRT2 Antibody - middle region is available in the following size(s): 25 µL.

Is KRT2 Antibody - middle region in stock?

KRT2 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

KRT2 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Keratin 2, type II

Gene Aliases

K2e, KRTE, CK-2e, KRT2A, KRT2E

Gene ID

3849

Swiss Prot

P35908

Accession Number

NP_000414.2

Reactivity

Human

Immunogen

The immunogen for Anti-KRT2 antibody is: synthetic peptide directed towards the middle region of Human K22E

Target

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is expressed largely in the upper spinous layer of epidermal keratinocytes and mutations in this gene have been associated with bullous congenital ichthyosiform erythroderma. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GTRPINLEPIFQGYIDSLKRYLDGLTAERTSQNSELNNMQDLVEDYKKKY

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol