What is the catalog number for KLRC1 Antibody - N-terminal region?

The catalog number for KLRC1 Antibody - N-terminal region is ARP76330_P050-25UL.

What sizes are available for KLRC1 Antibody - N-terminal region?

KLRC1 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is KLRC1 Antibody - N-terminal region in stock?

KLRC1 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

KLRC1 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Killer cell lectin-like receptor subfamily C, member 1

Gene Aliases

NKG2, NKG2A, CD159A

Gene ID

3821

Swiss Prot

P26715

Accession Number

NP_998823.1

Reactivity

Human

Immunogen

The immunogen for Anti-KLRC1 antibody is: synthetic peptide directed towards the N-terminal region of Human NKG2A

Target

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

NQGVIYSDLNLPPNPKRQQRKPKGNKNSILATEQEITYAELNLQKASQDF

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol