Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4GALT1 Antibody - C-terminal region

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Beta-1,4-galactosyltransferase 1

Gene Aliases

GT1, GTB, CDG2D, GGTB2, B4GAL-T1, beta4Gal-T1

Gene ID

2683

Swiss Prot

P15291

Accession Number

NP_001488

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human B4GT1

Target

This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. This gene is unique among the beta4GalT genes because it encodes an enzyme that participates both in glycoconjugate and lactose biosynthesis. For the first activity, the enzyme adds galactose to N-acetylglucosamine residues that are either monosaccharides or the nonreducing ends of glycoprotein carbohydrate chains. The second activity is restricted to lactating mammary tissues where the enzyme forms a heterodimer with alpha-lactalbumin to catalyze UDP-galactose + D-glucose <=> UDP + lactose. The two enzymatic forms result from alternate transcription initiation sites and post-translational processing. Two transcripts, which differ only at the 5' end, with approximate lengths of 4.1 kb and 3.9 kb encode the same protein. The longer transcript encodes the type II membrane-bound, trans-Golgi resident protein involved in glycoconjugate biosynthesis. The shorter transcript encodes a protein which is cleaved to form the soluble lactose synthase.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQ

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

43kDa

Protein Length

398

NCBI Gene Symbol

B4GALT1

Host or Source

Rabbit

Protein Name

Beta-1,4-galactosyltransferase 1

Gene Name URL

B4GALT1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lnpep sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3744203 1.0 µg DNA

Lnpep sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
TTC28-AS1 AAV Vector (Human) (CMV)
48679101 1 µg

TTC28-AS1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
EHBP1 Antibody
MBS9611722-01 0.1 mL

EHBP1 Antibody

Sign In for Pricing
View Details
EHBP1 Antibody
MBS9611722-02 0.2 mL

EHBP1 Antibody

Sign In for Pricing
View Details
EHBP1 Antibody
MBS9611722-03 5x 0.2 mL

EHBP1 Antibody

Sign In for Pricing
View Details
Human Occludin (OCLN) CLIA Kit
abx493554-01 96 Tests

Human Occludin (OCLN) CLIA Kit

Sign In for Pricing
View Details