What is the catalog number for FGR Antibody - N-terminal region?

The catalog number for FGR Antibody - N-terminal region is ARP76159_P050-25UL.

What sizes are available for FGR Antibody - N-terminal region?

FGR Antibody - N-terminal region is available in the following size(s): 25 µL.

Is FGR Antibody - N-terminal region in stock?

FGR Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

FGR Antibody - N-terminal region

Selected Variant

ARP76159_P050-25UL

Size: 25 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

FGR proto-oncogene, Src family tyrosine kinase

Gene Aliases

SRC2, c-fgr, c-src2, p55-Fgr, p58-Fgr, p55c-fgr, p58c-fgr

Gene ID

2268

Swiss Prot

P09769

Accession Number

NP_001036194.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FGR

Target

This gene is a member of the Src family of protein tyrosine kinases (PTKs) . The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIR

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

59 kDa

Protein Length

167

NCBI Gene Symbol

FGR

Host or Source

Rabbit

Protein Name

Tyrosine-protein kinase Fgr

Gene Name URL

FGR

Nucleotide Accession Number

NM_001042729.1

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MRE11 Antibody Picoband®, iFluor647 Conjugate

A32234-1-iFluor647 100 µg