What is the catalog number for FGF12 Antibody - N-terminal region?

The catalog number for FGF12 Antibody - N-terminal region is ARP76155_P050-25UL.

What sizes are available for FGF12 Antibody - N-terminal region?

FGF12 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is FGF12 Antibody - N-terminal region in stock?

FGF12 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

FGF12 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Fibroblast growth factor 12

Gene Aliases

FHF1, DEE47, EIEE47, FGF12B

Gene ID

2257

Swiss Prot

P61328

Accession Number

NP_004104.3

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FGF12

Target

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

QKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRP

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol