Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCPZ Antibody - middle region (ARP75982_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Chaperonin containing TCP1 subunit 6A

Gene Aliases

CCT6, Cctz, HTR3, TCPZ, TCP20, MoDP-2, TTCP20, CCT-zeta, CCT-zeta-1, TCP-1-zeta

Gene ID

908

Swiss Prot

P40227-2

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TCPZ

Target

The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC) . This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, several pseudogenes of this gene have been located.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

HAGLVYEYTLGEEKFTFIEKCNNPRSVTLLIKGPNKHTLTQIKDAVRDGL

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

53kDa

Protein Length

486

NCBI Gene Symbol

CCT6A

Host or Source

Rabbit

Protein Name

T-complex protein 1 subunit zeta

Gene Name URL

CCT6A

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Terephthalic-d4 Acid
TRC-T112504-500MG 500 mg

Terephthalic-d4 Acid

Sign In for Pricing
View Details
Oleandomycin Phosphate
TRC-O517505-2.5MG 2.5 mg

Oleandomycin Phosphate

Sign In for Pricing
View Details
Nutm1 Recombinant Rabbit Monoclonal Antibody [PSH09-09]
HA721690 100 µL

Nutm1 Recombinant Rabbit Monoclonal Antibody [PSH09-09]

Sign In for Pricing
View Details
Human Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) ELISA Kit
RDR-DYRK1A-Hu-01 96 Tests

Human Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) ELISA Kit

Sign In for Pricing
View Details
Human Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) ELISA Kit
RDR-DYRK1A-Hu-02 48 Tests

Human Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) ELISA Kit

Sign In for Pricing
View Details
GRP78 (HSPA5) Mouse Monoclonal Antibody [Clone ID: OTI16C9]
CF815944 100 µg

GRP78 (HSPA5) Mouse Monoclonal Antibody [Clone ID: OTI16C9]

Sign In for Pricing
View Details