What is the catalog number for ARF1 Antibody - N-terminal region (ARP75924_P050)?

The catalog number for ARF1 Antibody - N-terminal region (ARP75924_P050) is ARP75924_P050.

What sizes are available for ARF1 Antibody - N-terminal region (ARP75924_P050)?

ARF1 Antibody - N-terminal region (ARP75924_P050) is available in the following size(s): 100 µL.

Is ARF1 Antibody - N-terminal region (ARP75924_P050) in stock?

ARF1 Antibody - N-terminal region (ARP75924_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

ARF1 Antibody - N-terminal region (ARP75924_P050)

Selected Variant

ARP75924_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

ADP ribosylation factor 1

Gene Aliases

PVNH8

Gene ID

375

Swiss Prot

P84077

Accession Number

NP_001019397.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ARF1

Target

ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGF

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

19 kDa

Protein Length

181

NCBI Gene Symbol

ARF1

Host or Source

Rabbit

Protein Name

ADP-ribosylation factor 1

Gene Name URL

ARF1

Nucleotide Accession Number

NM_001024226.1

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX10 (Melanoma Marker) (SOX10/2311R), CF405S conjugate, 0.1mg/mL

BNC042311-100 1x 100 µL