Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEH1 Antibody - N-terminal region (ARP75811_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

SEH1 like nucleoporin

Gene Aliases

Seh1, SEH1A, SEH1B, SEC13L

Gene ID

81929

Swiss Prot

Q96EE3

Accession Number

NP_112493

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SEH1

Target

The protein encoded by this gene is part of a nuclear pore complex, Nup107-160. This protein contains WD repeats and shares 34% amino acid identity with yeast Seh1 and 30% identity with yeast Sec13. All constituents of the Nup107-160 complex, including this protein, specifically localize to kinetochores in mitosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Partner Proteins

SUMO2; SUMO1; RPA3; RPA2; RPA1; NUP43; DCTN4; NUP160; DCTN2; NUP37; ACTR1B; HECW2; env; UBC; ATP6V0A1; NUP107; COPS5; ELAVL1; Nup98; SAP25; BECN1; USP32P2; RAE1; NUP85; NUP133

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

FDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGL

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

39kDa

Protein Length

360

NCBI Gene Symbol

SEH1L

Host or Source

Rabbit

Protein Name

Nucleoporin SEH1

Gene Name URL

SEH1L

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF1A1 Recombinant Rabbit mAb
E43S46096 100 µL

EEF1A1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
RNF122 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1837506 1.0 µg DNA

RNF122 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Porcine Stromal Cell Derived Factor 1 Alpha, , SDF-1A ELISA KIT
E0502Po-01 48 Well

Porcine Stromal Cell Derived Factor 1 Alpha, , SDF-1A ELISA KIT

Sign In for Pricing
View Details
Porcine Stromal Cell Derived Factor 1 Alpha, , SDF-1A ELISA KIT
E0502Po-02 96 Well

Porcine Stromal Cell Derived Factor 1 Alpha, , SDF-1A ELISA KIT

Sign In for Pricing
View Details
Porcine Stromal Cell Derived Factor 1 Alpha, , SDF-1A ELISA KIT
E0502Po-03 5x 96 Tests

Porcine Stromal Cell Derived Factor 1 Alpha, , SDF-1A ELISA KIT

Sign In for Pricing
View Details
Porcine Stromal Cell Derived Factor 1 Alpha, , SDF-1A ELISA KIT
E0502Po-04 10x 96 Tests

Porcine Stromal Cell Derived Factor 1 Alpha, , SDF-1A ELISA KIT

Sign In for Pricing
View Details