What is the catalog number for RNF7 Antibody - N-terminal region?

The catalog number for RNF7 Antibody - N-terminal region is ARP75260_P050-25UL.

What sizes are available for RNF7 Antibody - N-terminal region?

RNF7 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is RNF7 Antibody - N-terminal region in stock?

RNF7 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

RNF7 Antibody - N-terminal region

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Ring finger protein 7

Gene Aliases

SAG, ROC2, rbx2, CKBBP1

Gene ID

9616

Swiss Prot

Q9UBF6

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RBX2

Target

The protein encoded by this gene is a highly conserved ring finger protein. It is an essential subunit of SKP1-cullin/CDC53-F box protein ubiquitin ligases, which are a part of the protein degradation machinery important for cell cycle progression and signal transduction. This protein interacts with, and is a substrate of, casein kinase II (CSNK2A1/CKII) . The phosphorylation of this protein by CSNK2A1 has been shown to promote the degradation of IkappaBalpha (CHUK/IKK-alpha/IKBKA) and p27Kip1 (CDKN1B) . Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Partner Proteins

CUL5; UBE2D1; UBC; NEDD4; vif; ASB4; ASB7; ASB6; ASB10; ASB13; ASB2; Lrrc41; Wsb1; Socs1; UBE2F; VCP; SPSB4; SPSB2; SPSB1; RAB40C; SOCS3; nef; vpu; VHL; CDC34; TRIM8; TRIM46; CHFR; GLMN; RNF7; MKRN3; MNAT1; CSNK2B; CSNK2A1; SKP2; CUL1; BTRC; NFKBIA; NEDD4

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDAC

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol