What is the catalog number for RBX2 Antibody - N-terminal region (ARP75260_P050)?

The catalog number for RBX2 Antibody - N-terminal region (ARP75260_P050) is ARP75260_P050.

What sizes are available for RBX2 Antibody - N-terminal region (ARP75260_P050)?

RBX2 Antibody - N-terminal region (ARP75260_P050) is available in the following size(s): 100 µL.

Is RBX2 Antibody - N-terminal region (ARP75260_P050) in stock?

RBX2 Antibody - N-terminal region (ARP75260_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

RBX2 Antibody - N-terminal region (ARP75260_P050)

Selected Variant

ARP75260_P050

Size: 100 µL

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Ring finger protein 7

Gene Aliases

SAG, ROC2, rbx2, CKBBP1

Gene ID

9616

Swiss Prot

Q9UBF6

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RBX2

Target

The protein encoded by this gene is a highly conserved ring finger protein. It is an essential subunit of SKP1-cullin/CDC53-F box protein ubiquitin ligases, which are a part of the protein degradation machinery important for cell cycle progression and signal transduction. This protein interacts with, and is a substrate of, casein kinase II (CSNK2A1/CKII) . The phosphorylation of this protein by CSNK2A1 has been shown to promote the degradation of IkappaBalpha (CHUK/IKK-alpha/IKBKA) and p27Kip1 (CDKN1B) . Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Partner Proteins

CUL5; UBE2D1; UBC; NEDD4; vif; ASB4; ASB7; ASB6; ASB10; ASB13; ASB2; Lrrc41; Wsb1; Socs1; UBE2F; VCP; SPSB4; SPSB2; SPSB1; RAB40C; SOCS3; nef; vpu; VHL; CDC34; TRIM8; TRIM46; CHFR; GLMN; RNF7; MKRN3; MNAT1; CSNK2B; CSNK2A1; SKP2; CUL1; BTRC; NFKBIA; NEDD4

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDAC

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

12kDa

Protein Length

113

NCBI Gene Symbol

RNF7

Host or Source

Rabbit

Protein Name

RING-box protein 2

Gene Name URL