What is the catalog number for PRKAR2B Antibody - N-terminal region (ARP75056_P050)?

The catalog number for PRKAR2B Antibody - N-terminal region (ARP75056_P050) is ARP75056_P050.

What sizes are available for PRKAR2B Antibody - N-terminal region (ARP75056_P050)?

PRKAR2B Antibody - N-terminal region (ARP75056_P050) is available in the following size(s): 100 µL.

Is PRKAR2B Antibody - N-terminal region (ARP75056_P050) in stock?

PRKAR2B Antibody - N-terminal region (ARP75056_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

PRKAR2B Antibody - N-terminal region (ARP75056_P050)

Selected Variant

ARP75056_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

Protein kinase, cAMP-dependent, regulatory, type II, beta

Gene Aliases

PRKAR2, RII-BETA

Gene ID

5577

Swiss Prot

P31323

Accession Number

NP_002727.2

Reactivity

Human

Immunogen

The immunogen for Anti-PRKAR2B antibody is: synthetic peptide directed towards the N-terminal region of Human KAP3

Target

CAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is one of the regulatory subunits. This subunit can be phosphorylated by the activated catalytic subunit. This subunit has been shown to interact with and suppress the transcriptional activity of the cAMP responsive element binding protein 1 (CREB1) in activated T cells. Knockout studies in mice suggest that this subunit may play an important role in regulating energy balance and adiposity. The studies also suggest that this subunit may mediate the gene induction and cataleptic behavior induced by haloperidol.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQ

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

45 kDa

Protein Length

418

NCBI Gene Symbol

PRKAR2B

Host or Source

Rabbit

Gene Name URL