What is the catalog number for HNRNPAB Antibody - C-terminal region?

The catalog number for HNRNPAB Antibody - C-terminal region is ARP74944_P050-25UL.

What sizes are available for HNRNPAB Antibody - C-terminal region?

HNRNPAB Antibody - C-terminal region is available in the following size(s): 25 µL.

Is HNRNPAB Antibody - C-terminal region in stock?

HNRNPAB Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

HNRNPAB Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Heterogeneous nuclear ribonucleoprotein A/B

Gene Aliases

ABBP1, HNRPAB

Gene ID

3182

Swiss Prot

Q99729

Accession Number

NP_112556

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HNRNPAB

Target

This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs) . The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes. They are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene, which binds to one of the components of the multiprotein editosome complex, has two repeats of quasi-RRM (RNA recognition motif) domains that bind to RNAs. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQ

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

36 kDa

Protein Length

332

NCBI Gene Symbol

HNRNPAB

Host or Source

Rabbit

Protein Name

Heterogeneous nuclear ribonucleoprotein A/B

Gene Name URL

HNRNPAB

Nucleotide Accession Number

NM_031266.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNC400851-100 1x 100 µL