What is the catalog number for UGT1A4 Antibody - N-terminal region (ARP74887_P050)?

The catalog number for UGT1A4 Antibody - N-terminal region (ARP74887_P050) is ARP74887_P050.

What sizes are available for UGT1A4 Antibody - N-terminal region (ARP74887_P050)?

UGT1A4 Antibody - N-terminal region (ARP74887_P050) is available in the following size(s): 100 µL.

Is UGT1A4 Antibody - N-terminal region (ARP74887_P050) in stock?

UGT1A4 Antibody - N-terminal region (ARP74887_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

UGT1A4 Antibody - N-terminal region (ARP74887_P050)

Selected Variant

ARP74887_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

UDP glucuronosyltransferase family 1 member A4

Gene Aliases

GNT1, UGT1, UDPGT, UGT1A, UGT1D, UGT-1A, UGT-1D, UGT1.1, UGT1.4, UGT1A1, HUG-BR2, UGT1-01, UGT1-04, UGT1A4S, hUG-BR1, UDPGT 1-4

Gene ID

54657

Swiss Prot

P22310

Accession Number

NP_009051.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human UGT1A4

Target

This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. This enzyme has some glucuronidase activity towards bilirubin, although is is more active on amines, steroids, and sapogenins.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

EEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLKRYSRSMAIMNNV

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

58 kDa

Protein Length

534

NCBI Gene Symbol

UGT1A4

Host or Source

Rabbit

Protein Name

UDP-glucuronosyltransferase 1-4

Gene Name URL

UGT1A4

Nucleotide Accession Number

NM_007120.2

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (C-43), CF405S conjugate, 0.1mg/mL

BNC040688-100 1x 100 µL