Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNAB2 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Potassium channel, voltage gated subfamily A regulatory beta subunit 2

Gene Aliases

AKR6A5, KCNA2B, HKvbeta2, KV-BETA-2, HKvbeta2.1, HKvbeta2.2

Gene ID

8514

Swiss Prot

Q13303-3

Accession Number

NP_001186789.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCNAB2

Target

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog (s) . This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

TWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKE

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

45 kDa

Protein Length

415

NCBI Gene Symbol

KCNAB2

Host or Source

Rabbit

Protein Name

Voltage-gated potassium channel subunit beta-2

Gene Name URL

KCNAB2

Nucleotide Accession Number

NM_001199860.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLVI2 sgRNA CRISPR Lentivector set (Human)
K1309401 3x 1.0 µg

MLVI2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Mouse NACHT, LRR and PYD domains-containing protein 4C (NLRP4C) ELISA Kit
abx534469 96 Tests

Mouse NACHT, LRR and PYD domains-containing protein 4C (NLRP4C) ELISA Kit

Sign In for Pricing
View Details
SARS-CoV-2 (B.1.621) S1+S2 trimer Protein (ECD, His Tag)(HPLC-verified)
MBS8126081-01 0.1 mg

SARS-CoV-2 (B.1.621) S1+S2 trimer Protein (ECD, His Tag)(HPLC-verified)

Sign In for Pricing
View Details
SARS-CoV-2 (B.1.621) S1+S2 trimer Protein (ECD, His Tag)(HPLC-verified)
MBS8126081-02 5x 0.1 mg

SARS-CoV-2 (B.1.621) S1+S2 trimer Protein (ECD, His Tag)(HPLC-verified)

Sign In for Pricing
View Details
Cytomegalovirus Late Nuclear Antigen (CMV, HCMV, Human Herpes virus 5, HHV-5, HHV5) (PE)
MBS6251757-01 0.1 mL

Cytomegalovirus Late Nuclear Antigen (CMV, HCMV, Human Herpes virus 5, HHV-5, HHV5) (PE)

Sign In for Pricing
View Details
Cytomegalovirus Late Nuclear Antigen (CMV, HCMV, Human Herpes virus 5, HHV-5, HHV5) (PE)
MBS6251757-02 5x 0.1 mL

Cytomegalovirus Late Nuclear Antigen (CMV, HCMV, Human Herpes virus 5, HHV-5, HHV5) (PE)

Sign In for Pricing
View Details