What is the catalog number for H2AFZ Antibody - N-terminal region?

The catalog number for H2AFZ Antibody - N-terminal region is ARP74550_P050-25UL.

What sizes are available for H2AFZ Antibody - N-terminal region?

H2AFZ Antibody - N-terminal region is available in the following size(s): 25 µL.

Is H2AFZ Antibody - N-terminal region in stock?

H2AFZ Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

H2AFZ Antibody - N-terminal region

Selected Variant

ARP74550_P050-25UL

Size: 25 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

H2A histone family member Z

Gene Aliases

H2AZ, H2A.z, H2A/z, H2AFZ, H2A.Z-1

Gene ID

3015

Swiss Prot

P0C0S5

Accession Number

NP_002097.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human H2AFZ

Target

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4) . The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent member of the histone H2A family that is distinct from other members of the family. Studies in mice have shown that this particular histone is required for embryonic development and indicate that lack of functional histone H2A leads to embryonic lethality.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

AGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATA

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

14 kDa

Protein Length

128

NCBI Gene Symbol

H2AFZ

Host or Source

Rabbit

Protein Name

Histone H2A.Z

Gene Name URL

H2AFZ

Nucleotide Accession Number

NM_002106.3

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR (GFR1195), CF488A conjugate, 0.1mg/mL

BNC881195-500 1x 500 µL