Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP2M1 Antibody - Middle region

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Aliases

Mu2, Ap50, Clapm1

Gene ID

116563

Swiss Prot

P84092

Accession Number

NP_446289.1

Reactivity

Rat

Immunogen

The immunogen is a synthetic peptide directed towards the Middle region of Rat AP2M1

Target

AP2M1 is a component of the adaptor protein complex 2 (AP-2) . Adaptor protein complexes function in protein transport via transport vesicles in different membrane traffic pathways. It is an adaptor protein which complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrounded by clathrin (clathrin- coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

YLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRL

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

47 kDa

Protein Length

435

NCBI Gene Symbol

AP2M1

Host or Source

Rabbit

Gene Name URL

AP2M1

More Discoveries

Explore Other Products

Browse additional items from our catalog

p63 (TP63) (NM_001114982) Human Tagged Lenti ORF Clone
RC225607L4 10 µg

p63 (TP63) (NM_001114982) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lipopolysaccharides (LPS) Antibody
abx403550-01 100 µL

Lipopolysaccharides (LPS) Antibody

Sign In for Pricing
View Details
Lipopolysaccharides (LPS) Antibody
abx403550-02 200 µL

Lipopolysaccharides (LPS) Antibody

Sign In for Pricing
View Details
Lipopolysaccharides (LPS) Antibody
abx403550-03 1 mL

Lipopolysaccharides (LPS) Antibody

Sign In for Pricing
View Details
RGS11 Protein Vector (Human) (pPM-C-HA)
PV057127 500 ng

RGS11 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Golt1a (NM_026680) Mouse Tagged Lenti ORF Clone
MR200785L4 10 µg

Golt1a (NM_026680) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details