What is the catalog number for OR7E24 Antibody - C-terminal region?

The catalog number for OR7E24 Antibody - C-terminal region is ARP72286_P050-25UL.

What sizes are available for OR7E24 Antibody - C-terminal region?

OR7E24 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is OR7E24 Antibody - C-terminal region in stock?

OR7E24 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

OR7E24 Antibody - C-terminal region

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Aliases

HSHT2, OR19-8, OR7E24P, OR7E24Q

Gene ID

26648

Swiss Prot

Q6IFN5

Accession Number

NP_001073404

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR7E24

Target

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

IYFMGAIFGCLPISGILFSYYKIVSPILRVPTSDGKYKAFSTCGSHLAVV

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol