Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10K2 Antibody - C-terminal region

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Aliases

OR1-4

Gene ID

391107

Swiss Prot

Q6IF99

Accession Number

NP_001004476

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10K2

Target

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VSHLIIVTVHYGCASFIYLRPQSNYSSSQDALISVSYTIITPLFNPMIYS

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 91%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

34kDa

Protein Length

312

NCBI Gene Symbol

OR10K2

Host or Source

Rabbit

Gene Name URL

OR10K2

Nucleotide Accession Number

NM_001004476

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TST (NM_001270483) AAV Particle
RC232404A1V 250 µL

Human TST (NM_001270483) AAV Particle

Sign In for Pricing
View Details
Mouse Monoclonal bcl-x Antibody (rBCL2L1/4508) [FITC]
NBP3-14164F 0.1 mL

Mouse Monoclonal bcl-x Antibody (rBCL2L1/4508) [FITC]

Sign In for Pricing
View Details
GCKR (Glucokinase Regulatory Protein, Glucokinase Regulator) discontinued see 151524
G2023-36C 100 µg

GCKR (Glucokinase Regulatory Protein, Glucokinase Regulator) discontinued see 151524

Sign In for Pricing
View Details
CD108 Antibody
GWB-6C176D 0.1 mg

CD108 Antibody

Sign In for Pricing
View Details
MAP Kinase p38, beta (Mitogen-activated Protein Kinase p38 beta, MAP Kinase p38 beta, p38beta, P38beta2, p38b, Mitogen-activated Protein Kinase 11, MAP Kinase 11, MAPK 11, MAPK11, PRKM11, p38-2, Stress-activated Protein Kinase 2b, SAPK2b, SAPK2) (MaxLight 405) discontinued
M2352-09T-ML405 100 µL

MAP Kinase p38, beta (Mitogen-activated Protein Kinase p38 beta, MAP Kinase p38 beta, p38beta, P38beta2, p38b, Mitogen-activated Protein Kinase 11, MAP Kinase 11, MAPK 11, MAPK11, PRKM11, p38-2, Stress-activated Protein Kinase 2b, SAPK2b, SAPK2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
FZR1 mouse monoclonal antibody, clone DCS-266, Azide Free
AM00318AF-N 100 µg

FZR1 mouse monoclonal antibody, clone DCS-266, Azide Free

Sign In for Pricing
View Details