Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4A16 Antibody - C-terminal region (ARP71058_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Aliases

OR4A16Q, OR11-117

Gene ID

81327

Swiss Prot

Q8NH70

Accession Number

NP_001005274

Reactivity

Human, Pig

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4A16

Target

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

FLLISCGVILNFLKTYSQEERHKALPTCISHIIVVALVFVPCIFMYVRPV

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Human: 100%; Pig: 83%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

36kDa

Protein Length

328

NCBI Gene Symbol

OR4A16

Host or Source

Rabbit

Protein Name

Olfactory receptor 4A16

Gene Name URL

OR4A16

Nucleotide Accession Number

NM_001005274

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Polyclonal Goat anti-Feline IgG (H+L) Secondary Antibody [HRP]
NBP1-73347 2 mg

Goat Polyclonal Goat anti-Feline IgG (H+L) Secondary Antibody [HRP]

Sign In for Pricing
View Details
Cluster Of Differentiation 97 (CD97) Monoclonal Antibody
CAU33744-01 100 µL

Cluster Of Differentiation 97 (CD97) Monoclonal Antibody

Sign In for Pricing
View Details
Cluster Of Differentiation 97 (CD97) Monoclonal Antibody
CAU33744-02 200 µL

Cluster Of Differentiation 97 (CD97) Monoclonal Antibody

Sign In for Pricing
View Details
Cluster Of Differentiation 97 (CD97) Monoclonal Antibody
CAU33744-03 1 mL

Cluster Of Differentiation 97 (CD97) Monoclonal Antibody

Sign In for Pricing
View Details
CASP10, ID (Caspase-10, CASP-10, ICE-like Apoptotic Protease 4, Apoptotic Protease Mch-4, FAS-associated Death Domain Protein Interleukin-1B-converting Enzyme 2, FLICE2, Caspase-10 Subunit p23/17, Caspase-10 Subunit p12, MCH4) (APC) discontinued
C2088-50B-APC 200 µL

CASP10, ID (Caspase-10, CASP-10, ICE-like Apoptotic Protease 4, Apoptotic Protease Mch-4, FAS-associated Death Domain Protein Interleukin-1B-converting Enzyme 2, FLICE2, Caspase-10 Subunit p23/17, Caspase-10 Subunit p12, MCH4) (APC) discontinued

Sign In for Pricing
View Details
LRP4 Recombinant Mouse monoclonal Antibody
HA610226 100 µg

LRP4 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details