Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NBPF15 Antibody - N-terminal region (ARP70932_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Neuroblastoma breakpoint family member 15

Gene Aliases

AG3, AB14, NBPF16

Gene ID

284565

Swiss Prot

Q5SXJ2

Accession Number

NP_001164226.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human NBPF15

Target

This gene is a member of the neuroblastoma breakpoint family (NBPF) which consists of dozens of recently duplicated genes primarily located in segmental duplications on human chromosome 1. This gene family has experienced its greatest expansion within the human lineage and has expanded, to a lesser extent, among primates in general. Members of this gene family are characterized by tandemly repeated copies of DUF1220 protein domains. Gene copy number variations in the human chromosomal region 1q21.1, where most DUF1220 domains are located, have been implicated in a number of developmental and neurogenetic diseases such as microcephaly, macrocephaly, autism, schizophrenia, mental retardation, congenital heart disease, neuroblastoma, and congenital kidney and urinary tract anomalies. Altered expression of some gene family members is associated with several types of cancer. This gene family contains numerous pseudogenes.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VQKLSPENDNDDDEDVQVEVAEKVQKSSAPREMQKAEEKEVPEDSLEECA

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Human: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

73kDa

Protein Length

670

NCBI Gene Symbol

NBPF15

Host or Source

Rabbit

Protein Name

Neuroblastoma breakpoint family member 15

Gene Name URL

NBPF15

Nucleotide Accession Number

NM_001170755.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse V-set and transmembrane domain-containing protein 5 (Vstm5), partial
MBS1378151-01 0.5 mg (E-Coli)

Recombinant Mouse V-set and transmembrane domain-containing protein 5 (Vstm5), partial

Sign In for Pricing
View Details
Recombinant Mouse V-set and transmembrane domain-containing protein 5 (Vstm5), partial
MBS1378151-02 0.05 mg (Baculovirus)

Recombinant Mouse V-set and transmembrane domain-containing protein 5 (Vstm5), partial

Sign In for Pricing
View Details
Recombinant Mouse V-set and transmembrane domain-containing protein 5 (Vstm5), partial
MBS1378151-03 0.5 mg (Yeast)

Recombinant Mouse V-set and transmembrane domain-containing protein 5 (Vstm5), partial

Sign In for Pricing
View Details
Recombinant Mouse V-set and transmembrane domain-containing protein 5 (Vstm5), partial
MBS1378151-04 0.05 mg (Mammalian-Cell)

Recombinant Mouse V-set and transmembrane domain-containing protein 5 (Vstm5), partial

Sign In for Pricing
View Details
Recombinant Mouse V-set and transmembrane domain-containing protein 5 (Vstm5), partial
MBS1378151-05 1 mg (E-Coli)

Recombinant Mouse V-set and transmembrane domain-containing protein 5 (Vstm5), partial

Sign In for Pricing
View Details
Recombinant Mouse V-set and transmembrane domain-containing protein 5 (Vstm5), partial
MBS1378151-06 0.1 mg (Baculovirus)

Recombinant Mouse V-set and transmembrane domain-containing protein 5 (Vstm5), partial

Sign In for Pricing
View Details