What is the catalog number for DENND2A Antibody - N-terminal region?

The catalog number for DENND2A Antibody - N-terminal region is ARP70137_P050-25UL.

What sizes are available for DENND2A Antibody - N-terminal region?

DENND2A Antibody - N-terminal region is available in the following size(s): 25 µL.

Is DENND2A Antibody - N-terminal region in stock?

DENND2A Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

DENND2A Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Aliases

FAM31D, KIAA1277

Gene ID

27147

Swiss Prot

Q9ULE3

Accession Number

NP_056504

Reactivity

Human, Mouse, Rat, Cow, Dog, Horse, Pig

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DENND2A

Target

DENND2A is a guanine nucleotide exchange factor (GEF) which may activate RAB9A and RAB9B. It promotes the exchange of GDP to GTP, converting inactive GDP-bound Rab proteins into their active GTP-bound form and may play a role in late endosomes back to trans-Golgi network/TGN transport.

Partner Proteins

Dlg4

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DRSLENVYRGSEGSPTKPFINPLPKPRRTFKHAGEGDKDGKPGIGFRKEK

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol