What is the catalog number for INTS11 Antibody - C-terminal region?

The catalog number for INTS11 Antibody - C-terminal region is ARP68235_P050-25UL.

What sizes are available for INTS11 Antibody - C-terminal region?

INTS11 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is INTS11 Antibody - C-terminal region in stock?

INTS11 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

INTS11 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Integrator complex subunit 11

Gene Aliases

RC68, INT11, RC-68, CPSF3L, CPSF73L

Gene ID

54973

Swiss Prot

Q5TA45

Accession Number

NP_001243385.1

Reactivity

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human CPSF3L

Target

The Integrator complex contains at least 12 subunits and associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates the 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 180690) . INTS11, or CPSF3L, is the catalytic subunit of the Integrator complex (Baillat et al., 2005 [PubMed 16239144]) .[supplied by OMIM, Mar 2008]

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

TESTYATTIRDSKRCRERDFLKKVHETVERGGKGAHEPEGAHLLLHGADR

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol