What is the catalog number for TLNRD1 Antibody - N-terminal region?

The catalog number for TLNRD1 Antibody - N-terminal region is ARP67656_P050-25UL.

What sizes are available for TLNRD1 Antibody - N-terminal region?

TLNRD1 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is TLNRD1 Antibody - N-terminal region in stock?

TLNRD1 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

TLNRD1 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Talin rod domain containing 1

Gene Aliases

MESDC1

Gene ID

59274

Swiss Prot

Q9H1K6

Accession Number

NP_072088

Reactivity

Human, Mouse, Rat, Cow, Dog, Horse

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MESDC1

Target

This gene encodes a protein that is regulated by micro RNA MiR-574-3, and is thought to have an oncogenic function in human bladder cancer. A similar gene in mouse is located in a chromosomal region critical for differentiation of mesoderm, which affects embryo patterning and the formation of heart, muscle, blood, skeleton and the urogenital system. The mouse gene is expressed in early development, and in the adult.

Partner Proteins

ELAVL1; LRP6

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

AIGGASSQPRKRLVSVCDHCKGKMQLVADLLLLSSEARPVLFEGPASSGA

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol