What is the catalog number for SH3D19 Antibody - C-terminal region (ARP67291_P050)?

The catalog number for SH3D19 Antibody - C-terminal region (ARP67291_P050) is ARP67291_P050.

What sizes are available for SH3D19 Antibody - C-terminal region (ARP67291_P050)?

SH3D19 Antibody - C-terminal region (ARP67291_P050) is available in the following size(s): 100 µL.

Is SH3D19 Antibody - C-terminal region (ARP67291_P050) in stock?

SH3D19 Antibody - C-terminal region (ARP67291_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

SH3D19 Antibody - C-terminal region (ARP67291_P050)

Selected Variant

ARP67291_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

SH3 domain containing 19

Gene Aliases

EBP, EVE1, Kryn, Eve-1, SH3P19

Gene ID

152503

Swiss Prot

Q5HYK7-4

Reactivity

Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SH3D19

Target

This gene encodes a multiple SH3 domain-containing protein, which interacts with other proteins, such as EBP and members of ADAM family, via the SH3 domains. This protein may be involved in suppression of Ras-induced cellular transformation and Ras-mediated activation of ELK1 by EBP, and regulation of ADAM proteins in the signaling of EGFR-ligand shedding. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Partner Proteins

SH3YL1; SH3KBP1; ELAVL1; Cd2ap; GRB2; CDC42; ADAM15; ADAM17; SH3GL3; ADAM12; ADAM9; ADAM10; SH3GL1; SOS2

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GRVHLSQMKIITPLDEHLRSRPNDPSHAQKPVDSGAPHAVVLHDFPAEQV

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 85%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Pig: 93%; Rabbit: 92%; Rat: 79%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

46kDa

Protein Length

420

NCBI Gene Symbol

SH3D19

Host or Source

Rabbit

Protein Name

SH3 domain-containing protein 19

Gene Name URL